General Information

  • ID:  hor005792
  • Uniprot ID:  P18829
  • Protein name:  Adipokinetic hormone I4-10
  • Gene name:  NA
  • Organism:  Schistocerca gregaria (Desert locust) (Gryllus gregarius)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistocerca (genus), Cyrtacanthacridinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FTPNWGT
  • Length:  7(26-32)
  • Propeptide:  MVQRCLVVALLVVVVAAALCSAQLNFTPNWGTGKRDAADFGDPYSFLYRLIQAEARKMSGCSN
  • Signal peptide:  MVQRCLVVALLVVVVAAALCSA
  • Modification:  T7 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P18829-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005792_AF2.pdbhor005792_ESM.pdb

Physical Information

Mass: 92908 Formula: C39H51N9O11
Absent amino acids: ACDEHIKLMQRSVY Common amino acids: T
pI: 6.11 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -71.43 Boman Index: -553
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -3318.57 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  2576372
  • Title:  Synthesis of a homodimer neurohormone precursor of locust adipokinetic hormone studied by in vitro translation and cDNA cloning.
  • PubMed ID:  2627375
  • Title:  Dimer structure of a neuropeptide precursor established: consequences for processing.
  • PubMed ID:  958472
  • Title:  Structure of locust adipokinetic hormo
  • PubMed ID:  1941082
  • Title: